Fields »
ABOUT
HELP
BLOG
CS

ANTIBODY INFORMATION
 
 

Antibody HPA038460

  

Antibody HPA038461

  

Antibody CAB075750

  

Antibody CAB075751

  

Antibody CAB075752

  

Antibody CAB075753

  

Antibody CAB075754

  

Provider

 Atlas Antibodies
Sigma-Aldrich
   Atlas Antibodies
Sigma-Aldrich
   Atlas Antibodies
Sigma-Aldrich
   Atlas Antibodies
Sigma-Aldrich
   Atlas Antibodies
Sigma-Aldrich
   Atlas Antibodies
Sigma-Aldrich
   Atlas Antibodies
Sigma-Aldrich
  

Product name

 HPA038460   HPA038461   AMAb91005   AMAb91006   AMAb91007   AMAb91008   AMAb91009  

Host species

 Rabbit   Rabbit   Mouse   Mouse   Mouse   Mouse   Mouse  

Clonality

 pAb   pAb   mAb   mAb   mAb   mAb   mAb  

Purity

 Affinity purified using the PrEST-antigen as affinity ligand   Affinity purified using the PrEST-antigen as affinity ligand   Protein A/G   Protein A/G   Protein A/G   Protein A/G   Protein A/G  

Other gene match

              

Released in version

 10   10   14   14   14   14   14  

References

              

VALIDATION SUMMARY
 
 

Antibody HPA038460

  

Antibody HPA038461

  

Antibody CAB075750

  

Antibody CAB075751

  

Antibody CAB075752

  

Antibody CAB075753

  

Antibody CAB075754

  
Immunocytochemistry


Validated

Validated
  

Validated
            
Immunohistochemistry

Supported   Supported   Supported   Supported   Supported   Supported   Supported  
Western blot

Supported   Supported   Supported   Supported   Supported   Supported   Supported  
Protein array

Supported   Supported            

IMMUNOCYTOCHEMISTRY
 
 

Antibody HPA038460

  

Antibody HPA038461

  

Antibody CAB075750

  

Antibody CAB075751

  

Antibody CAB075752

  

Antibody CAB075753

  

Antibody CAB075754

  

Formal validation: Genetic
Validated

Significant downregulation > 25% by one siRNA.		              

 

Relative fluorescence intensity (RFI)

              

Figure description

 Whole cells of segmented cells in 10x-images              

Antibody dilution

 1:25              
 

Formal validation: Independent
Validated

Antibody staining overlaps with antibody HPA038461.		  
Validated

Antibody staining overlaps with antibody HPA038460.		            
 

Standard validation

 Supported   Supported            

             

Figure description

 Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.   Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.            

Antibody dilution

 1:25   1:62            

Literature conformity

 The subcellular location is supported by literature.   The subcellular location is supported by literature.            

IMMUNOHISTOCHEMISTRY
 
 

Antibody HPA038460

  

Antibody HPA038461

  

Antibody CAB075750

  

Antibody CAB075751

  

Antibody CAB075752

  

Antibody CAB075753

  

Antibody CAB075754

  

Standard validation

 Supported   Supported   Supported   Supported   Supported   Supported   Supported  

             

Figure description

 Immunohistochemical staining of human colon shows strong cytoplasmic positivity, seen with a granular pattern, in glandular cells.   Immunohistochemical staining of human heart muscle shows strong cytoplasmic positivity in myocytes.   Immunohistochemical staining of human duodenum shows cytoplasmic positivity in glandular cells.   Immunohistochemical staining of human small intestine shows strong cytoplasmic positivity with a granular pattern in glandular cells.   Immunohistochemical staining of human duodenum shows cytoplasmic positivity in glandular cells.   Immunohistochemical staining of human duodenum shows cytoplasmic positivity in glandular cells.   Immunohistochemical staining of human small intestine shows strong cytoplasmic positivity with a granular pattern in glandular cells.  

Expression

 RNA: detected in 37 tissues
Protein: detected in 72 cell types		   RNA: detected in 37 tissues
Protein: detected in 79 cell types		   RNA: detected in 37 tissues
Protein: detected in 76 cell types		   RNA: detected in 37 tissues
Protein: detected in 80 cell types		   RNA: detected in 37 tissues
Protein: detected in 75 cell types		   RNA: detected in 37 tissues
Protein: detected in 75 cell types		   RNA: detected in 37 tissues
Protein: detected in 79 cell types		  

Retrieval

 HIER pH6   HIER pH6   HIER pH6   HIER pH6   HIER pH6   HIER pH6   HIER pH6  

Antibody dilution

 1:35   1:500   1:8000   1:8000   1:2500   1:6000   1:500  

Literature conformity

 Consistent with gene/protein characterization data.   Consistent with gene/protein characterization data.   Consistent with extensive gene/protein characterization data.   Consistent with extensive gene/protein characterization data.   Consistent with extensive gene/protein characterization data.   Consistent with extensive gene/protein characterization data.   Consistent with extensive gene/protein characterization data.  

RNA consistency

 Mainly consistent with RNA expression data.   Mainly consistent with RNA expression data.   Mainly consistent with RNA expression data.   Mainly consistent with RNA expression data.   Mainly consistent with RNA expression data.   Mainly consistent with RNA expression data.   Mainly consistent with RNA expression data.  

WESTERN BLOT
 
 

Antibody HPA038460

  

Antibody HPA038461

  

Antibody CAB075750

  

Antibody CAB075751

  

Antibody CAB075752

  

Antibody CAB075753

  

Antibody CAB075754

  

Standard validation

 Supported

Analysis performed using a standard panel of samples.
Single band corresponding to the predicted size in kDa (+/-20%).		   Supported

Analysis performed using a standard panel of samples.
Single band corresponding to the predicted size in kDa (+/-20%).		   Supported

Analysis performed using a standard panel of samples.
Single band corresponding to the predicted size in kDa (+/-20%).		   Supported

Analysis performed using a standard panel of samples.
Single band corresponding to the predicted size in kDa (+/-20%).		   Supported

Analysis performed using a standard panel of samples.
Single band corresponding to the predicted size in kDa (+/-20%).		   Supported

Analysis performed using a standard panel of samples.
Single band corresponding to the predicted size in kDa (+/-20%).		   Supported

Analysis performed using a standard panel of samples.
Single band corresponding to the predicted size in kDa (+/-20%).		  

             

Figure description

 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil		   Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil		   Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil		   Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil		   Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil		   Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil		   Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil		  

Target mass (kDa)

 51.7, 50.4, 44.7   51.7, 50.4, 19.4, 16.3   51.7, 50.4, 44.7, 19.4, 17, 16.3, 16.1, 16, 15.8, 15.6, 15.5, 14.1, 13.3, 13.1, 12.6, 9.1, 7.4   51.7, 50.4, 44.7, 19.4, 17, 16.3, 16.1, 16, 15.8, 15.6, 15.5, 14.1, 13.3, 13.1, 12.6, 9.1, 7.4   51.7, 50.4, 44.7, 19.4, 17, 16.3, 16.1, 16, 15.8, 15.6, 15.5, 14.1, 13.3, 13.1, 12.6, 9.1, 7.4   51.7, 50.4, 44.7, 19.4, 17, 16.3, 16.1, 16, 15.8, 15.6, 15.5, 14.1, 13.3, 13.1, 12.6, 9.1, 7.4   51.7, 50.4, 44.7, 19.4, 17, 16.3, 16.1, 16, 15.8, 15.6, 15.5, 14.1, 13.3, 13.1, 12.6, 9.1, 7.4  

Antibody dilution

 1:250   1:250   1:500   1:500   1:500   1:500   1:500  

PROTEIN ARRAY
 
 

Antibody HPA038460

  

Antibody HPA038461

  

Antibody CAB075750

  

Antibody CAB075751

  

Antibody CAB075752

  

Antibody CAB075753

  

Antibody CAB075754

  

Standard validation

 Supported

Pass with single peak corresponding to interaction only with its own antigen.		   Supported

Pass with single peak corresponding to interaction only with its own antigen.		            

             

Figure description

 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.   Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.            

Antibody dilution

 1:3000   1:3000            

ANTIGEN INFORMATION
 
 

Antibody HPA038460

  

Antibody HPA038461

  

Antibody CAB075750

  

Antibody CAB075751

  

Antibody CAB075752

  

Antibody CAB075753

  

Antibody CAB075754

  

Antigen

 Recombinant protein fragment   Recombinant protein fragment   Recombinant protein   Recombinant protein   Recombinant protein   Recombinant protein   Recombinant protein  

Length (aa)

 91   100            

Antigen sequence

 
LDWSHNFTNMLGYTDHQFTELTRLYLTIHSDHEGGNVSAHTSHLVGSALS
DPYLSFAAAMNGLAGPLHGLANQEVLVWLTQLQKEVGKDVS
  
ADLIPKEQARIKTFRQQHGKTVVGQITVDMMYGGMRGMKGLVYETSVLDP
DEGIRFRGFSIPECQKLLPKAKGGEEPLPEGLFWLLVTGHIPTEEQVSWL
  

											 
																						

											 
																						

											 
																						

											 
																						

											 
																				

																		

										
											
Matching transcripts

												
																					CS-001 - ENSP00000342056 [100%] 
CS-002 - ENSP00000446779 [100%] 
CS-003 - ENSP00000440543 [100%] 

											 
																						CS-001 - ENSP00000342056 [100%] 
CS-003 - ENSP00000440543 [100%] 
CS-013 - ENSP00000448172 [100%] 
CS-033 - ENSP00000447986 [96%] 

											 
																						
											 
																						
											 
																						
											 
																						
											 
																						
											 
																				

																		

										
											
Other gene match

												
																					
											 
																						
											 
																						
											 
																						
											 
																						
											 
																						
											 
																						
											 
																				

																		

										ANTIGEN VIEW
									
									
										

		
			

				

										
						

							

								

									
CS-001
CS-002
CS-003
CS-013
CS-033
								

							

						

							
									

			

				
	

	

		
			
				
	

													
															
				
						

				 
			

		

			
	











	

		


			

				

					Contact
				

				
				

					
					
					
					
				

				
			


			

				

					The Project
				
			
				
			

			
			

			
				

					The Human Protein Atlas
				

				
			

			
			

			

						The Human Protein Atlas project is funded
by the Knut & Alice Wallenberg foundation.