Fields »
ABOUT
HELP
BLOG
POTEJ

ANTIBODY INFORMATION
 
 

Antibody HPA041264

  

Antibody HPA041271

  

Antibody HPA042822

  

Antibody HPA043260

  

Provider

 Atlas Antibodies
Sigma-Aldrich
   Atlas Antibodies
Sigma-Aldrich
   Atlas Antibodies
Sigma-Aldrich
   Atlas Antibodies
Sigma-Aldrich
  

Product name

 HPA041264   HPA041271   HPA042822   HPA043260  

Host species

 Rabbit   Rabbit   Rabbit   Rabbit  

Clonality

 pAb   pAb   pAb   pAb  

Purity

 Affinity purified using the PrEST-antigen as affinity ligand   Affinity purified using the PrEST-antigen as affinity ligand   Affinity purified using the PrEST-antigen as affinity ligand   Affinity purified using the PrEST-antigen as affinity ligand  

Other gene match

 ACTB - ENSG00000075624 [100%]
ACTA2 - ENSG00000107796 [96%]
ACTA1 - ENSG00000143632 [96%]
ACTC1 - ENSG00000159251 [96%]
ACTG2 - ENSG00000163017 [96%]
ACTBL2 - ENSG00000169067 [92%]
ACTG1 - ENSG00000184009 [100%]
POTEE - ENSG00000188219 [100%]
POTEF - ENSG00000196604 [100%]
POTEI - ENSG00000196834 [100%]
   ACTB - ENSG00000075624 [100%]
ACTA2 - ENSG00000107796 [97%]
ACTA1 - ENSG00000143632 [97%]
ACTC1 - ENSG00000159251 [97%]
ACTG2 - ENSG00000163017 [97%]
ACTBL2 - ENSG00000169067 [92%]
ACTG1 - ENSG00000184009 [100%]
POTEE - ENSG00000188219 [84%]
POTEF - ENSG00000196604 [84%]
POTEI - ENSG00000196834 [84%]
   POTED - ENSG00000166351 [98%]
POTEC - ENSG00000183206 [98%]
POTEG - ENSG00000187537 [95%]
POTEE - ENSG00000188219 [95%]
POTEF - ENSG00000196604 [95%]
POTEI - ENSG00000196834 [93%]
POTEH - ENSG00000198062 [95%]
POTEM - ENSG00000222036 [95%]
POTEB2 - ENSG00000230031 [98%]
POTEB - ENSG00000233917 [98%]
AC136352.4 - ENSG00000276760 [98%]
BX072566.1 - ENSG00000277630 [100%]
POTEB3 - ENSG00000278522 [98%]
   POTEE - ENSG00000188219 [100%]
POTEF - ENSG00000196604 [100%]
POTEI - ENSG00000196834 [100%]
  

Released in version

 10   10   10   10  

References

        

VALIDATION SUMMARY
 
 

Antibody HPA041264

  

Antibody HPA041271

  

Antibody HPA042822

  

Antibody HPA043260

  
Immunohistochemistry

Uncertain   Uncertain   Uncertain   Uncertain  
Western blot

Supported   Uncertain   Uncertain   Uncertain  
Protein array

Approved   Supported   Supported   Supported  

IMMUNOHISTOCHEMISTRY
 
 

Antibody HPA041264

  

Antibody HPA041271

  

Antibody HPA042822

  

Antibody HPA043260

  

Standard validation

 Uncertain   Uncertain   Uncertain   Uncertain  

       

Figure description

 Immunohistochemical staining of human stomach, upper shows strong membranous positivity in glandular cells.   Immunohistochemical staining of human stomach, upper shows strong membranous positivity in glandular cells.   Immunohistochemical staining of human testis shows strong cytopolasmic positivity in cells in seminiferus ducts and leydig cells.   Immunohistochemical staining of human breast shows moderate cytoplasmic and membranous positivity in glandular cells.  

Expression

 RNA: detected in 1 tissues
Protein: detected in 73 cell types		   RNA: detected in 1 tissues
Protein: detected in 37 cell types		   RNA: detected in 1 tissues
Protein: detected in 63 cell types		   RNA: detected in 1 tissues
Protein: detected in 60 cell types		  

Retrieval

 HIER pH6   HIER pH6   HIER pH6   HIER pH6  

Antibody dilution

 1:1800   1:150   1:1000   1:800  

Literature conformity

 Consistent with extensive gene/protein characterization data.   Consistent with extensive gene/protein characterization data.   No avaliable gene/protein characterization data.   Consistent with gene/protein characterization data.  

RNA consistency

 Not consistent with RNA expression data.   Not consistent with RNA expression data.   Not consistent with RNA expression data.   Not consistent with RNA expression data.  

WESTERN BLOT
 
 

Antibody HPA041264

  

Antibody HPA041271

  

Antibody HPA042822

  

Antibody HPA043260

  

Standard validation

 Supported

Analysis performed using a standard panel of samples.
Band of predicted size in kDa (+/-20%) with additional bands present.		   Uncertain

Analysis performed using a standard panel of samples.
Weak band of predicted size but with additional bands of higher intensity also present.		   Uncertain

Analysis performed using a standard panel of samples.
Current setup is not applicable due to low RNA count.		   Uncertain

Analysis performed using a standard panel of samples.
Current setup is not applicable due to low RNA count.		  

       

Figure description

 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil		        

Target mass (kDa)

 121.4, 121.3, 117.4, 42.1, 42, 41.9, 41.8, 41.7, 37.1, 28.2, 26.9, 23.8, 18, 16.8   121.4, 121.3, 117.4, 42.1, 42, 41.9, 41.8, 41.7, 28.2, 26.9, 23.8, 18, 16.8, 16.3, 14.5, 13, 11.4, 11, 8.5   121.4, 121.3, 117.4, 66.4, 65.7, 61.7, 61.2, 61, 57.2, 57.1, 57, 56.9, 44.1, 42.9, 42.7, 42.6, 41.9, 41.8   121.4, 121.3, 117.4  

Antibody dilution

 1:250   1:250   1:250   1:250  

PROTEIN ARRAY
 
 

Antibody HPA041264

  

Antibody HPA041271

  

Antibody HPA042822

  

Antibody HPA043260

  

Standard validation

 Approved

Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%).		   Supported

Pass with single peak corresponding to interaction only with its own antigen.		   Supported

Pass with single peak corresponding to interaction only with its own antigen.		   Supported

Pass with single peak corresponding to interaction only with its own antigen.		  

       

Figure description

 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.   Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.   Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.   Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.  

Antibody dilution

 1:3000   1:3000   1:6000   1:6000  

ANTIGEN INFORMATION
 
 

Antibody HPA041264

  

Antibody HPA041271

  

Antibody HPA042822

  

Antibody HPA043260

  

Antigen

 Recombinant protein fragment   Recombinant protein fragment   Recombinant protein fragment   Recombinant protein fragment  

Length (aa)

 26   37   41   24  

Antigen sequence

 
PKANREKMTQIMFETFNTPAMYVAIQ
  
MVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWD
  
YDHSAFMEPRYHVRREDLDKLHRAAWWGKVPRKDLIVMLRD
  
LKALQLNELTMDDDTAVLVIDNGS
 

Matching transcripts

 POTEJ-001 - ENSP00000387176 [100%]
  POTEJ-001 - ENSP00000387176 [84%]
  POTEJ-001 - ENSP00000387176 [93%]
  POTEJ-001 - ENSP00000387176 [100%]
 

Other gene match

 ACTB - ENSG00000075624 [100%]
ACTA2 - ENSG00000107796 [96%]
ACTA1 - ENSG00000143632 [96%]
ACTC1 - ENSG00000159251 [96%]
ACTG2 - ENSG00000163017 [96%]
ACTBL2 - ENSG00000169067 [92%]
ACTG1 - ENSG00000184009 [100%]
POTEE - ENSG00000188219 [100%]
POTEF - ENSG00000196604 [100%]
POTEI - ENSG00000196834 [100%]
   ACTB - ENSG00000075624 [100%]
ACTA2 - ENSG00000107796 [97%]
ACTA1 - ENSG00000143632 [97%]
ACTC1 - ENSG00000159251 [97%]
ACTG2 - ENSG00000163017 [97%]
ACTBL2 - ENSG00000169067 [92%]
ACTG1 - ENSG00000184009 [100%]
POTEE - ENSG00000188219 [84%]
POTEF - ENSG00000196604 [84%]
POTEI - ENSG00000196834 [84%]
   POTED - ENSG00000166351 [98%]
POTEC - ENSG00000183206 [98%]
POTEG - ENSG00000187537 [95%]
POTEE - ENSG00000188219 [95%]
POTEF - ENSG00000196604 [95%]
POTEI - ENSG00000196834 [93%]
POTEH - ENSG00000198062 [95%]
POTEM - ENSG00000222036 [95%]
POTEB2 - ENSG00000230031 [98%]
POTEB - ENSG00000233917 [98%]
AC136352.4 - ENSG00000276760 [98%]
BX072566.1 - ENSG00000277630 [100%]
POTEB3 - ENSG00000278522 [98%]
   POTEE - ENSG00000188219 [100%]
POTEF - ENSG00000196604 [100%]
POTEI - ENSG00000196834 [100%]
  
ANTIGEN VIEW
POTEJ-001
 

Contact

The Project

The Human Protein Atlas

The Human Protein Atlas project is funded
by the Knut & Alice Wallenberg foundation.